PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00029503-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 127aa    MW: 13638.4 Da    PI: 5.9321
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00029503-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-185297147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
  WALNUT_00029503-RA 52 KGPWSPEEDAILSRLVSKFGARNWSLIARGIS-GRSGKSCRLRWCNQ 97
                        79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.85547102IPR017930Myb domain
SMARTSM007176.2E-1551100IPR001005SANT/Myb domain
PfamPF002494.1E-175297IPR001005SANT/Myb domain
SuperFamilySSF466894.99E-1853108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-2353108IPR009057Homeodomain-like
CDDcd001671.71E-155496No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MEVEEVAVAD VGKMEASEAI EGCGDAGSGD EEVVVAVDGG GSRGRGGRDR VKGPWSPEED  60
AILSRLVSKF GARNWSLIAR GISGRSGKSC RLRWCNQLDP AVKRKPFTGT VPIFLDLNPS  120
FSYLLHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1749108463B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008448879.13e-44PREDICTED: transcription factor MYB86
TrEMBLA0A0A0KXF89e-44A0A0A0KXF8_CUCSA; Uncharacterized protein
STRINGVIT_13s0019g03200.t015e-35(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2009255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-27myb domain protein 109